Glyt2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20931
Zusätzliche Namen:: GLYT-2|GLYT2|HKPX3|NET1
Anwendung:: ELISA, WB
Molekulargewicht:: 87kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTA
Uniprot:: Q9Y345
Synonyme:: GLYT-2;GLYT2;HKPX3;NET1;sodium- and chloride-dependent glycine transporter 2;solute carrier family 6 (neurotransmitter transporter, glycine), member 5;Solute carrier family 6 member 5
Weitere Details:: This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene.