A20929
Syndecan 3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A20929
- Zusätzliche Namen:
- SDCN|SYND3|Syndecan 3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVDLEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFS
- Uniprot:
- O75056
- Synonyme:
- N-syndecan;SDCN;SYND3;syndecan neural type;syndecan proteoglycan 3;syndecan-3
- Weitere Details:
- The protein encoded by this gene belongs to the syndecan proteoglycan family. It may play a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism. Allelic variants of this gene have been associated with obesity.
- Versandbedingungen:
- Blue Ice