SF3A3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20927
Zusätzliche Namen:: PRP9|PRPF9|SAP61|SF3A3|SF3a60
Anwendung:: ELISA, WB
Molekulargewicht:: 62kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPN
Uniprot:: Q12874
Synonyme:: pre-mRNA splicing factor SF3a (60kD);PRP9;PRPF9;SAP 61;SAP61;SF3a60;spliceosome associated protein 61;Spliceosome-associated protein 61;splicing factor 3A subunit 3;splicing factor 3a, subunit 3, 60kD;splicing factor 3a, subunit 3, 60kDa
Weitere Details:: This gene encodes subunit 3 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 3 interacts with subunit 1 through its amino-terminus while the zinc finger domain of subunit 3 plays a role in its binding to the 15S U2 snRNP. This gene has a pseudogene on chromosome 20. Alternative splicing results in multiple transcript variants.