CYFIP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20924
Zusätzliche Namen:: CYFIP1|P140SRA-1|SHYC|SRA-1|SRA1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 145kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNE
Uniprot:: Q7L576
Synonyme:: cytoplasmic FMR1-interacting protein 1;cytoplasmic FMRP interacting protein 1;P140SRA-1;selective hybridizing clone;SHYC;specifically Rac1-associated protein 1;SRA-1;SRA1
Weitere Details:: This gene encodes a protein that regulates cytoskeletal dynamics and protein translation. The encoded protein is a component of the WAVE regulatory complex (WRC), which promotes actin polymerization. This protein also interacts with the synaptic functional regulator FMR1 protein and translation initiation factor 4E to inhibit protein translation. A large chromosomal deletion including this gene is associated with increased risk of schizophrenia and epilepsy in human patients. Reduced expression of this gene has been observed in various human cancers and the encoded protein may inhibit tumor invasion.