A20919
PIN4 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A20919
- Zusätzliche Namen:
- EPVH|hEPVH|hPar14|hPar17|PAR14|PAR17|PIN4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
- Uniprot:
- Q9Y237
- Synonyme:
- EPVH;eukaryotic parvulin homolog;hEPVH;hPar14;hPar17;PAR14;PAR17;parvulin;parvulin-14;parvulin-17;peptidyl-prolyl cis-trans isomerase NIMA-interacting 4;peptidyl-prolyl cis-trans isomerase Pin4;peptidyl-prolyl cis/trans isomerase EPVH;PPIase PIN4;protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin);rotamase PIN4
- Weitere Details:
- This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria.
- Versandbedingungen:
- Blue Ice

