SPINK5 / LEKTI Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20916
Zusätzliche Namen:: LEKTI|LETKI|NETS|NS|SPINK5 / LEKTI|VAKTI
Anwendung:: ELISA, WB
Molekulargewicht:: 37kDa/65kDa/145kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAMCAEL
Uniprot:: Q9NQ38
Synonyme:: LEKTI;LETKI;lympho-epithelial Kazal-type-related inhibitor;lymphoepithelial Kazal-type-related inhibitor;NETS;NS;serine protease inhibitor Kazal-type 5;VAKTI
Weitere Details:: This gene encodes a multidomain serine protease inhibitor that contains 15 potential inhibitory domains. The encoded preproprotein is proteolytically processed to generate multiple protein products, which may exhibit unique activities and specificities. These proteins may play a role in skin and hair morphogenesis, as well as anti-inflammatory and antimicrobial protection of mucous epithelia. Mutations in this gene may result in Netherton syndrome, a disorder characterized by ichthyosis, defective cornification, and atopy. This gene is present in a gene cluster on chromosome 5. Alternative splicing results in multiple transcript variants.