A20914
PEF1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A20914
- Zusätzliche Namen:
- ABP32|PEF1|PEF1A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- APGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSS
- Uniprot:
- Q9UBV8
- Synonyme:
- ABP32;epididymis secretory sperm binding protein;PEF protein with a long N-terminal hydrophobic domain;PEF1A;peflin;Penta-EF hand domain-containing protein 1
- Weitere Details:
- This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. The encoded protein has been shown to form a heterodimer with the programmed cell death 6 gene product and may modulate its function in Ca(2+) signaling. Alternative splicing results in multiple transcript variants and a pseudogene has been identified on chromosome 1.
- Versandbedingungen:
- Blue Ice