BCKDK Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20909
Zusätzliche Namen:: BCKDK|BCKDKD|BDK
Anwendung:: ELISA, WB
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MILASVLRSGPGGGLPLRPLLGPALALRARSTSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPV
Uniprot:: O14874
Synonyme:: [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial;3-methyl-2-oxobutanoate dehydrogenase [lipoamide] kinase, mitochondrial;BCKD-kinase;BCKDHKIN;BCKDKD;BDK;branched chain alpha-ketoacid dehydrogenase kinase;branched chain ketoacid dehydrogenase kinase;Branched-chain alpha-ketoacid dehydrogenase kinase
Weitere Details:: The branched-chain alpha-ketoacid dehydrogenase complex (BCKD) is an important regulator of the valine, leucine, and isoleucine catabolic pathways. The protein encoded by this gene is found in the mitochondrion, where it phosphorylates and inactivates BCKD. Several transcript variants encoding different isoforms have been found for this gene.