A20900
SARA Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A20900
- Zusätzliche Namen:
- MADHIP|NSP|PPP1R173|SARA|SMADIP
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 180kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MENYFQAEAYNLDKVLDEFEQNEDETVSSTLLDTKWNKILDPPSHRLSFNPTLASVNESAVSNESQPQLKVFSLAHSAPLTTEEEDHCANGQDCNLNPEI
- Uniprot:
- O95405
- Synonyme:
- MAD, mothers against decapentaplegic homolog interacting protein, receptor activation anchor;MADH-interacting protein;MADHIP;Mothers against decapentaplegic homolog-interacting protein;novel serine protease;NSP;PPP1R173;protein phosphatase 1, regulatory subunit 173;Receptor activation anchor;SARA;smad anchor for receptor activation;SMADIP;zinc finger FYVE domain-containing protein 9;zinc finger, FYVE domain containing 9
- Weitere Details:
- This gene encodes a double zinc finger motif-containing protein that participates in the transforming growth factor-beta (TGFB) signalling pathway. The encoded protein interacts directly with SMAD2 and SMAD3, and recruits SMAD2 to the TGFB receptor. There are multiple pseudogenes for this gene on chromosomes 2, 15, and X. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice