A20897
NAT1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A20897
- Zusätzliche Namen:
- AAC1|MNAT|NAT-1|NAT1|NATI
- Anwendung:
- ELISA, IF, ICC
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKK
- Uniprot:
- P18440
- Synonyme:
- AAC1;arylamide acetylase 1;arylamine N-acetyltransferase 1;MNAT;monomorphic arylamine N-acetyltransferase;N-acetyltransferase 1 (arylamine N-acetyltransferase);N-acetyltransferase type 1;NAT-1;NATI
- Weitere Details:
- This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice