HINT1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20894
Zusätzliche Namen:: HINT|HINT1|NMAN|PKCI-1|PRKCNH1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNE
Uniprot:: P49773
Synonyme:: adenosine 5'-monophosphoramidase;epididymis secretory sperm binding protein;HINT;histidine triad nucleotide-binding protein 1;NMAN;PKCI-1;PRKCNH1;protein kinase C inhibitor 1;protein kinase C-interacting protein 1
Weitere Details:: This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed.