TRAPPC2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20890
Zusätzliche Namen:: hYP38334|MIP2A|SEDL|SEDT|TRAPPC2|TRAPPC2P1|TRS20|ZNF547L
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 16 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFT
Uniprot:: P0DI81
Synonyme:: hYP38334;MIP2A;SEDL;sedlin;SEDT;trafficking protein particle complex 2;trafficking protein particle complex subunit 2;TRAPPC2P1;TRS20;ZNF547L
Weitere Details:: The protein encoded by this gene is thought to be part of a large multi-subunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind c-myc promoter-binding protein 1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseudogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants have been found for this gene.