A2088
IL1RA Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A2088
- Zusätzliche Namen:
- DIRA|ICIL-1RA|IL-1ra|IL-1ra3|IL-1RN|IL1F3|IL1RA|IRAP|MVCD4
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 18kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
- Uniprot:
- P18510
- Synonyme:
- DIRA;ICIL-1RA;IL-1ra;IL-1ra3;IL-1RN;IL1 inhibitor;IL1F3;IL1RA;interleukin-1 receptor antagonist protein;intracellular IL-1 receptor antagonist type II;intracellular interleukin-1 receptor antagonist (icIL-1ra);IRAP;MVCD4;type II interleukin-1 receptor antagonist
- Weitere Details:
- The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Versandbedingungen:
- Blue Ice