A20872
Epsin 1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A20872
- Zusätzliche Namen:
- EPN1|Epsin 1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 90 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKA
- Uniprot:
- Q9Y6I3
- Synonyme:
- EH domain-binding mitotic phosphoprotein;EPS-15-interacting protein 1;epsin-1
- Weitere Details:
- This gene encodes a member of the epsin protein family. The encoded protein binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Loss of function of this gene is associated with reduced tumor growth and progression in certain cancer types.
- Versandbedingungen:
- Blue Ice