P2Y12 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20864
Zusätzliche Namen:: 2900079B22Rik|4921504D23Rik|P2Y12
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FLGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDKDVTKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKVPKKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTSMLRCSNSTSTSGTNKKKGQEGGEPSEETPM
Uniprot:: Q9CPV9
Synonyme:: 2900079B22Rik;4921504D23Rik;hHIPk2;homeodomain-interacting protein kinase 2;P2Y purinoceptor 12;P2Y1;P2Y12;PRO0593
Weitere Details:: Enables G protein-coupled ADP receptor activity and G protein-coupled adenosine receptor activity. Involved in several processes, including cellular response to ATP; regulation of microglial cell migration; and substrate-dependent cell migration, cell extension. Acts upstream of or within several processes, including adenylate cyclase-modulating G protein-coupled receptor signaling pathway; platelet activation; and positive regulation of ion transport. Located in cell body membrane and cell projection membrane. Is expressed in central nervous system and cerebral cortex. Used to study platelet-type bleeding disorder 8. Human ortholog(s) of this gene implicated in asthma; cerebrovascular disease; peripheral artery disease; platelet-type bleeding disorder 8; and type 2 diabetes mellitus. Orthologous to human P2RY12 (purinergic receptor P2Y12).

Versandbedingungen:: Blue Ice