A20863
Bag1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A20863
- Zusätzliche Namen:
- BAG-1|Bag1|HAP|RAP46
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 33kDa/46kDa/52kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- WSEEATQSEEATQGEEMNRSQEVTRDEESTRSEEVTREEMAAAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEM
- Uniprot:
- Q99933
- Synonyme:
- BAG family molecular chaperone regulator 1;BAG-1;Bcl-2 associating athanogene-1 protein;Bcl-2-associated athanogene 1;Bcl-2-binding protein;BCL2 associated athanogene 1;BCL2-associated athanogene;glucocortoid receptor-associated protein RAP46;HAP;RAP46;receptor-associated protein, 46-KD
- Weitere Details:
- The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. Multiple protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) initiation codon, and three alternative downstream AUG initiation codons. A related pseudogene has been defined on chromosome X.
- Versandbedingungen:
- Blue Ice








