HNF4A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2085
Zusätzliche Namen:: FRTS4|HNF4|HNF4A|HNF4a7|HNF4a8|HNF4a9|HNF4alpha|MODY|MODY1|NR2A1|NR2A21|TCF|TCF-14|TCF14
Anwendung:: ELISA, WB
Molekulargewicht:: 52kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYIND
Uniprot:: P41235
Synonyme:: FRTS4;hepatic nuclear factor 4 alpha;hepatocyte nuclear factor 4-alpha;HNF4;HNF4a7;HNF4a8;HNF4a9;HNF4alpha;HNF4alpha10/11/12;MODY;MODY1;NR2A1;NR2A21;nuclear receptor subfamily 2 group A member 1;TCF;TCF-14;TCF14;transcription factor 14;transcription factor HNF-4
Weitere Details:: The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.

Versandbedingungen:: Blue Ice