A20841
Annexin A11 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A20841
- Zusätzliche Namen:
- ALS23|Annexin A11|ANX11|CAP-50|CAP50|IBMWMA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 56kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND
- Uniprot:
- P50995
- Synonyme:
- 56 kDa autoantigen;ALS23;annexin A11;annexin XI;annexin-11;ANX11;calcyclin-associated annexin 50;CAP-50;CAP50;epididymis secretory sperm binding protein
- Weitere Details:
- This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified.
- Versandbedingungen:
- Blue Ice