[KD Validated] IRAK4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20839
Zusätzliche Namen:: [KD Validated] IRAK4|IMD67|IPD1|IRAK-4|NY-REN-64|REN64
Anwendung:: ELISA, WB
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVV
Uniprot:: Q9NWZ3
Synonyme:: IMD67;interleukin-1 receptor-associated kinase 4;IPD1;IRAK-4;NY-REN-64;REN64;renal carcinoma antigen NY-REN-64
Weitere Details:: This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene.