A20839
[KD Validated] IRAK4 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A20839
- Zusätzliche Namen:
- [KD Validated] IRAK4|IMD67|IPD1|IRAK-4|NY-REN-64|REN64
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVV
- Uniprot:
- Q9NWZ3
- Synonyme:
- IMD67;interleukin-1 receptor-associated kinase 4;IPD1;IRAK-4;NY-REN-64;REN64;renal carcinoma antigen NY-REN-64
- Weitere Details:
- This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice
![[KD Validated] IRAK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A20839/A20839_1.jpg)
![[KD Validated] IRAK4 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A20839/A20839_ARC51289-01_KO-WB_01.jpg)