Timm29 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20812
Zusätzliche Namen:: 1810026J23Rik|TIM29|Timm29
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 29kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YLQPRWVDFPGRILDVGFVGRWWILQNRMHDCDINDDEFLHLPAHLRVVAPHQLHSEANERLFEEKYKPIILTDDQVDQALWEEQVLQKERKDRLALSEADSLVQSDVSR
Uniprot:: Q8BGX2
Synonyme:: 1810026J23Rik;mitochondrial import inner membrane translocase subunit Tim29;TIM29;uncharacterized protein C19orf52 homolog
Weitere Details:: Predicted to enable protein transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Predicted to be located in mitochondrial inner membrane and mitochondrial intermembrane space. Predicted to be part of TIM22 mitochondrial import inner membrane insertion complex. Orthologous to human TIMM29 (translocase of inner mitochondrial membrane 29).