Osteocalcin (BGLAP) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20800
Zusätzliche Namen:: BGP|OC|OCN|Osteocalcin (BGLAP)
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 11kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRR
Uniprot:: P02818
Synonyme:: BGP;bone gamma-carboxyglutamate (gla) protein (osteocalcin);Bone Gla protein;gamma-carboxyglutamic acid-containing protein;OC;OCN;osteocalcin
Weitere Details:: This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product.