YKL-40/CHI3L1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A20792
Zusätzliche Namen:: ASRT7|CGP-39|GP-39|GP39|HC-gp39|hCGP-39|HCGP-3P|YK-40|YKL-40|YKL-40/CHI3L1|YKL40|YYL-40
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 30-40 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT
Uniprot:: P36222
Synonyme:: 39 kDa synovial protein;ASRT7;cartilage glycoprotein 39;CGP-39;chitinase 3-like 1 (cartilage glycoprotein-39);chitinase-3-like protein 1;GP-39;GP39;HC-gp39;hCGP-39;HCGP-3P;YK-40;YKL-40;YKL40;YYL-40
Weitere Details:: Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling.