A20725
PIF4 Rabbit polyclonal antibody
Größe
Auf Anfrage
- SKU:
- A20725
- Zusätzliche Namen:
- AtPIF4|MFL8_13|MFL8.13|phytochrome interacting factor 4|PIF4|SRL2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Plant
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Plant
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IDYLKSLQLQLQVMWMGSGMAAAAASAPMMFPGVQPQQFIRQIQSPVQLPRFPVMDQSAIQNNPGLVCQNPVQNQIISDRFARYIGGFPHMQAATQMQPME
- Uniprot:
- Q8W2F3
- Synonyme:
- AT2G43010;AtPIF4;Basic helix-loop-helix protein 9;bHLH transcription factor bHLH009;MFL8_13;MFL8.13;phytochrome interacting factor 4;Phytochrome-interacting factor 4;Short under red-light 2;SRL2;Transcription factor EN 102
- Weitere Details:
- Isolated as a semidominant mutation defective in red -light responses. Encodes a nuclear localized bHLH protein that interacts with active PhyB protein. Negatively regulates phyB mediated red light responses. Involved in shade avoidance response. Protein abundance is negatively regulated by PhyB.
- Versandbedingungen:
- Blue Ice