A20723
IL10 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A20723
- Zusätzliche Namen:
- CSIF|If2a|Il-10|IL10
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 18kDa/21kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
- Uniprot:
- P18893
- Synonyme:
- CSIF;cytokine synthesis inhibitory factor;GVHDS;If2a;IL-;IL-10;IL10A;interferon 2a;interleukin-10;T-cell growth inhibitory factor;TGIF
- Weitere Details:
- This gene encodes an anti-inflammatory cytokine that is a member of the class-2 cytokine family. The encoded protein is secreted by cells of both the innate and adaptive immune systems and is crucial for limiting the immune response to a broad range of pathogens. It also has been shown to suppress autoimmune responses. This protein mediates it's immunosuppressive signal through a specific interleukin 10 receptor complex. Aberrant functioning of this gene is associated with numerous immune disorders including graft-versus-host disease, and increased susceptibility to HIV-1 infection and rheumatoid arthritis.
- Versandbedingungen:
- Blue Ice

_WB_01.jpg)