IKKA Alpha Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2062
Zusätzliche Namen:: BPS2|IKBKA|IKK-alpha|IKK1|IKKA|IKKA Alpha|NFKBIKA|TCF16
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 85kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTP
Uniprot:: O15111
Synonyme:: BPS2;conserved helix-loop-helix ubiquitous kinase;I-kappa-B kinase 1;I-kappa-B kinase-alpha;IkB kinase alpha subunit;IKBKA;IKK-a kinase;IKK-alpha;IKK1;IKKA;inhibitor of nuclear factor kappa-B kinase subunit alpha;NFKBIKA;Nuclear factor NF-kappa-B inhibitor kinase alpha;Nuclear factor NFkappaB inhibitor kinase alpha;TCF-16;TCF16;transcription factor 16
Weitere Details:: This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor.