HCoV-HKU1 Spike S1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20613
Anwendung:: ELISA, WB
Molekulargewicht:: 75kDa/110kDa/145kDa
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NGIFSRVKNTKLYVNKTLYSEFSTIVIGSVFINNSYTIVVQPHNGVLEITACQYTMCEYPHTICKSKGSSRNESWHFDKSEPLCLFKKNFTYNVSTDWLYF
Uniprot:: Q5MQD0
Synonyme:: E2;HCHV1gp3;Peplomer protein;spike glycoprotein
Weitere Details:: [Spike protein S1]: attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.