HCoV-HKU1 Nucleoprotein Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20612
Anwendung:: ELISA, WB
Molekulargewicht:: 50-60kDa
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPG
Uniprot:: Q5MQC6
Synonyme:: HCHV1gp7;nucleocapsid phosphoprotein;Nucleocapsid protein
Weitere Details:: Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.