A20602
INTS6 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A20602
- Zusätzliche Namen:
- DBI-1|DDX26|DDX26A|DICE1|HDB|INT6|INTS6|Notchl2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 117kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN
- Uniprot:
- Q9UL03
- Synonyme:
- DBI-1;DDX26;DDX26A;DEAD box protein;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26;DICE1;HDB;INT6;integrator complex subunit 6;Notchl2;Protein DDX26;protein deleted in cancer 1;RNA helicase HDB
- Weitere Details:
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and is located in the critical region of loss of heterozygosity (LOH). Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

