A2057
Cyclin T1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2057
- Zusätzliche Namen:
- CCNT|Cyclin T1|CYCT1|HIVE1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 81kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESS
- Uniprot:
- O60563
- Synonyme:
- CCNT;CDK9-associated C-type protein;cyclin C-related protein;cyclin-T1;CYCT1;HIVE1;human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1;MLLT10/CCNT1 fusion
- Weitere Details:
- This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

