RRP8 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20557
Zusätzliche Namen:: KIAA0409|NML|RRP8
Anwendung:: ELISA, WB
Molekulargewicht:: 58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHAPINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKN
Uniprot:: O43159
Synonyme:: cerebral protein 1;KIAA0409;NML;nucleomethylin;ribosomal RNA processing 8, methyltransferase, homolog;ribosomal RNA-processing protein 8;RRP8 methyltransferase homolog
Weitere Details:: Enables methylated histone binding activity. Involved in several processes, including cellular response to glucose starvation; intrinsic apoptotic signaling pathway by p53 class mediator; and regulation of gene expression. Located in several cellular components, including cytosol; nuclear lumen; and rDNA heterochromatin. Part of chromatin silencing complex.