CYP39A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20530
Zusätzliche Namen:: CYP39A1
Anwendung:: ELISA, WB
Molekulargewicht:: 54kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNI
Uniprot:: Q9NYL5
Synonyme:: 24-hydroxycholesterol 7-alpha-hydroxylase;Cytochrome P450 39A1;cytochrome P450, family 39, subfamily A, polypeptide 1;cytochrome P450, subfamily XXXIX (oxysterol 7 alpha-hydroxylase), polypeptide 1;Oxysterol 7-alpha-hydroxylase
Weitere Details:: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is involved in the conversion of cholesterol to bile acids. Its substrates include the oxysterols 25-hydroxycholesterol, 27-hydroxycholesterol and 24-hydroxycholesterol. Alternate splicing results in multiple transcript variants.