DTX1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20499
Zusätzliche Namen:: DTX1|hDx-1|RNF140
Anwendung:: ELISA, WB
Molekulargewicht:: 67-72kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSW
Uniprot:: Q86Y01
Synonyme:: deltex 1, E3 ubiquitin ligase;deltex homolog 1;E3 ubiquitin-protein ligase DTX1;hDx-1;protein deltex-1;RING-type E3 ubiquitin transferase DTX1;RNF140
Weitere Details:: Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity.