A2048
ADRB2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2048
- Zusätzliche Namen:
- ADRB2|ADRB2R|ADRBR|B2AR|BAR|BETA2AR
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 50-100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNID
- Uniprot:
- P07550
- Synonyme:
- ADRB2R;ADRBR;adrenergic, beta-2-, receptor, surface;adrenoceptor beta 2 surface;B2AR;BAR;beta-2 adrenergic receptor;beta-2 adrenoceptor;beta-2 adrenoreceptor;BETA2AR;catecholamine receptor
- Weitere Details:
- This gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This receptor is also a transcription regulator of the alpha-synuclein gene, and together, both genes are believed to be associated with risk of Parkinson's Disease. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity, type 2 diabetes and cardiovascular disease.
- Versandbedingungen:
- Blue Ice





