A20473
IL18 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A20473
- Zusätzliche Namen:
- Igif|Il-18|IL18
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 22kDa/18kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
- Uniprot:
- P70380
- Synonyme:
- iboctadekin;IFN-gamma-inducing factor;Ig;IGIF;Il-;IL-1 gamma;IL-18;IL-1g;IL1F4;interferon gamma-inducing factor;interleukin 18 (interferon-gamma-inducing factor);interleukin-1 gamma;interleukin-18
- Weitere Details:
- Enables cytokine activity. Involved in lipid homeostasis; positive regulation of cell differentiation; and positive regulation of cold-induced thermogenesis. Acts upstream of or within several processes, including interleukin-18-mediated signaling pathway; positive regulation of NIK/NF-kappaB signaling; and positive regulation of interferon-gamma production. Located in extracellular space. Is expressed in several structures, including back skin; dorsal aorta; gut; lymphatic system; and reproductive system. Used to study atopic dermatitis. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; allergic rhinitis; autoimmune disease (multiple); biliary atresia; and hepatitis B. Orthologous to human IL18 (interleukin 18).
- Versandbedingungen:
- Blue Ice