PDLIM4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20463
Zusätzliche Namen:: PDLIM4|RIL
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPSGTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSRDCRVDLGSEVYRMLREPAEPVAAEPKQSGS
Uniprot:: P50479
Synonyme:: enigma homolog;LIM domain protein;LIM protein RIL;PDZ and LIM domain protein 4;reversion-induced LIM protein;RIL
Weitere Details:: Enables alpha-actinin binding activity; protein homodimerization activity; and protein phosphatase binding activity. Involved in actin cytoskeleton reorganization. Located in several cellular components, including lamellipodium; perinuclear region of cytoplasm; and stress fiber. Part of filamentous actin. Implicated in osteoporosis.