NDUFB8 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A20457
Zusätzliche Namen:: ASHI|CI-ASHI|MC1DN32|NDUFB8
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Uniprot:: O95169
Synonyme:: ASHI;CI-ASHI;complex I ASHI subunit;complex I-ASHI;MC1DN32;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa;NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial;NADH-ubiquinone oxidoreductase ASHI subunit;NADH:ubiquinone oxidoreductase ASHI subunit
Weitere Details:: Involved in mitochondrial respiratory chain complex I assembly. Located in endoplasmic reticulum and mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency 32. Biomarker of Alzheimer's disease and Parkinson's disease.