A20452
Rev-ErbA Alpha/NR1D1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A20452
- Zusätzliche Namen:
- ear-1|EAR1|hRev|Rev-ErbA Alpha/NR1D1|REVERBA|REVERBalpha|THRA1|THRAL
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
- Uniprot:
- P20393
- Synonyme:
- ear-1;EAR1;hRev;nuclear receptor Rev-ErbA-alpha;nuclear receptor subfamily 1 group D member 1;rev-erbA-alpha;Rev-ErbAalpha;REVERBA;REVERBalpha;THRA1;THRAL;V-erbA-related protein 1
- Weitere Details:
- This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein represses the circadian clock transcription factor aryl hydrocarbon receptor nuclear translocator-like protein 1 (ARNTL). This protein may also be involved in regulating genes that function in metabolic, inflammatory and cardiovascular processes.
- Versandbedingungen:
- Blue Ice