A20383
IL12A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A20383
- Zusätzliche Namen:
- CLMF|IL-12A|IL12A|NFSK|NKSF1|P35
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 35kDa/75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKT
- Uniprot:
- P29459
- Synonyme:
- CLMF;CLMF p35;cytotoxic lymphocyte maturation factor 1, p35;cytotoxic lymphocyte maturation factor 35 kDa subunit;IL-12 subunit p35;IL-12, subunit p35;IL-12A;IL35 subunit;interleukin 12, p35;interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35);interleukin-12 alpha chain;interleukin-12 subunit alpha;NF cell stimulatory factor chain 1;NFSK;NK cell stimulatory factor chain 1;NKSF1;P35
- Weitere Details:
- This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.
- Versandbedingungen:
- Blue Ice



