A20378
MSY2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A20378
- Zusätzliche Namen:
- CONTRIN|CSDA3|DBPC|MSY2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKW
- Uniprot:
- Q9Y2T7
- Synonyme:
- CONTRIN;CSDA3;DBPC;DNA-binding protein C;epididymis secretory sperm binding protein;germ cell specific Y-box binding protein;Germ cell-specific Y-box-binding protein;MSY2;MSY2 homolog;Y-box-binding protein 2
- Weitere Details:
- This gene encodes a nucleic acid binding protein which is highly expressed in germ cells. The encoded protein binds to a Y-box element in the promoters of certain genes but also binds to mRNA transcribed from these genes. Pseudogenes for this gene are located on chromosome 10 and 15.
- Versandbedingungen:
- Blue Ice