A2037
PVRL1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2037
- Zusätzliche Namen:
- CD111|CLPED1|ED4|HIgR|HV1S|HVEC|nectin-1|OFC7|PRR|PRR1|PVRL1|PVRR|PVRR1|SK-12
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYGDRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV
- Uniprot:
- Q15223
- Synonyme:
- CD111;CLPED1;ectodermal dysplasia 4 (Margarita Island type);ED4;herpes simplex virus type 1 sensitivity;herpes virus entry mediator C;herpesvirus Ig-like receptor;HIgR;HV1S;HVEC;nectin 1;Nectin cell adhesion molecule 1;nectin-1;OFC7;poliovirus receptor-like 1;poliovirus receptor-related 1 (herpesvirus entry mediator C);poliovirus receptor-related protein 1;PRR;PRR1;PVRL1;PVRR;PVRR1;SK-12
- Weitere Details:
- This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain (in some isoforms), and a cytoplasmic region. This protein acts as a receptor for glycoprotein D (gD) of herpes simplex viruses 1 and 2 (HSV-1, HSV-2), and pseudorabies virus (PRV) and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome (CLPED1) as well as non-syndromic cleft lip with or without cleft palate (CL/P). Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.
- Versandbedingungen:
- Blue Ice

