PCK1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2036
Zusätzliche Namen:: PCK1|PCKDC|PEPCK-C|PEPCK1|PEPCKC
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 69 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRISQM
Uniprot:: P35558
Synonyme:: PCKDC;PEP carboxykinase;PEPCK-C;PEPCK1;PEPCKC;phosphoenolpyruvate carboxykinase 1 (soluble);phosphoenolpyruvate carboxykinase, cytosolic;phosphoenolpyruvate carboxykinase, cytosolic [GTP];phosphoenolpyruvate carboxylase;phosphopyruvate carboxylase;serine-protein kinase PCK1
Weitere Details:: This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized.