TIGIT Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20350
Zusätzliche Namen:: TIGIT|VSIG9|VSTM3|WUCAM
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG
Uniprot:: Q495A1
Synonyme:: T-cell immunoreceptor with Ig and ITIM domains;V-set and immunoglobulin domain containing 9;V-set and immunoglobulin domain-containing protein 9;V-set and transmembrane domain containing 3;V-set and transmembrane domain-containing protein 3;VSIG9;VSIG9, VSTM3;VSTM3;Washington University cell adhesion molecule;WUCAM
Weitere Details:: This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.