SARS-CoV-2 ORF7a Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20307
Anwendung:: ELISA, WB
Molekulargewicht:: 17kDa
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS
Uniprot:: P0DTC7
Synonyme:: Accessory protein 7a;GU280_gp07;ORF7a protein;Protein U122;Protein X4
Weitere Details:: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF7a encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF7a protein is thought to be a type I transmembrane protein.