eIF4A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20251
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA
Uniprot:: P38919, P60842, Q14240
Synonyme:: ATP-dependent RNA helicase DDX48;ATP-dependent RNA helicase eIF4A-1;ATP-dependent RNA helicase eIF4A-2;ATP-dependent RNA helicase eIF4A-3;BM-010;DDX2A;DDX2B;DDX48;DEAD (Asp-Glu-Ala-Asp) box polypeptide 48;DEAD box protein 48;EIF-4A;eIF-4A-I;eIF-4A-II;eIF-4A-III;EIF4A;eIF4A-I;eIF4A-II;eIF4A-III;eIF4AIII;EIF4F;eukaryotic initiation factor 4A-I;eukaryotic initiation factor 4A-II;eukaryotic initiation factor 4A-III;eukaryotic initiation factor 4A-like NUK-34;eukaryotic initiation factor 4AI;eukaryotic translation initiation factor 4A;Eukaryotic translation initiation factor 4A isoform 3;Fal1;MUK34;NMP 265;NMP265;nuclear matrix protein 265;NUK34;RCPS
Weitere Details:: ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

Versandbedingungen:: Blue Ice