Btbd11 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20192
Zusätzliche Namen:: 6330404E16Rik|Btbd11
Anwendung:: ELISA, WB
Molekulargewicht:: 121kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMHSRHNSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELELLLLRSRDPRAGPAV
Uniprot:: Q6GQW0
Synonyme:: 6330404E16Rik;ankyrin repeat and BTB/POZ domain-containing protein BTBD11;BTB/POZ domain-containing protein 11
Weitere Details:: Predicted to enable protein heterodimerization activity. Acts upstream of or within SMAD protein signal transduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in central nervous system; dorsal root ganglion; genitourinary system; and thymus primordium. Orthologous to human BTBD11 (BTB domain containing 11).