Stella Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20176
Zusätzliche Namen:: 2410075G02Rik|PCG7|PGC7|Stella
Anwendung:: ELISA, WB
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN
Uniprot:: Q8QZY3
Synonyme:: 2410075G02Rik;compaction-associated protein 1;developmental pluripotency-associated protein 3;PCG7;PGC;PGC7;primordial germ cell 7;primordial germ cell protein 7;st;Stella
Weitere Details:: Enables methylated histone binding activity. Involved in negative regulation of DNA demethylation; protection of DNA demethylation of female pronucleus; and regulation of genetic imprinting. Acts upstream of or within embryonic cleavage. Located in cytoplasm; female pronucleus; and male pronucleus. Is expressed in several structures, including central nervous system; early conceptus; gonad; hindgut diverticulum; and primordial germ cell. Orthologous to human DPPA3 (developmental pluripotency associated 3).