HJURP Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20169
Zusätzliche Namen:: FAKTS|hFLEG1|HJURP|URLC9
Anwendung:: ELISA, WB
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPA
Uniprot:: Q8NCD3
Synonyme:: 14-3-3-associated AKT substrate;FAKTS;fetal liver expressing gene 1;fetal liver-expressing gene 1 protein;hFLEG1;Holliday junction recognition protein;up-regulated in lung cancer 9;URLC9
Weitere Details:: Enables histone binding activity and identical protein binding activity. Involved in several processes, including CENP-A containing chromatin assembly; regulation of DNA binding activity; and regulation of protein-containing complex assembly. Located in kinetochore; mitochondrion; and nuclear lumen.