A20167
WRAP53 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A20167
- Zusätzliche Namen:
- DKCB3|TCAB1|WDR79|WRAP53
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 72kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS
- Uniprot:
- Q9BUR4
- Synonyme:
- DKCB3;TCAB1;telomerase Cajal body protein 1;WD repeat-containing protein 79;WD repeat-containing protein WRAP53;WD40 protein Wrap53;WD40 repeat-containing protein antisense to TP53;WD40 repeat-containing protein antisense to TP53 gene;WD40 repeat-containing protein encoding RNA antisense to p53;WDR79;WRAP53beta
- Weitere Details:
- This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5' UTR have been found for this gene.
- Versandbedingungen:
- Blue Ice

