A20163
ATP6V1G2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A20163
- Zusätzliche Namen:
- ATP6G|ATP6G2|ATP6V1G2|NG38|VMA10
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLL
- Uniprot:
- O95670
- Synonyme:
- ATP6G;ATP6G2;ATPase, H+ transporting, lysosomal (vacuolar proton pump);ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2;H(+)-transporting two-sector ATPase, subunit G2;NG38;V-ATPase 13 kDa subunit 2;V-type proton ATPase subunit G 2;vacuolar ATP synthase subunit G 2;vacuolar proton pump G subunit 2;Vacuolar proton pump subunit G 2;VMA10
- Weitere Details:
- This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described. Read-through transcription also exists between this gene and the downstream DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B (DDX39B) gene.
- Versandbedingungen:
- Blue Ice





