HOXB2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A20158
Zusätzliche Namen:: Hox-2.8|HOX2|HOX2H|HOXB2|K8
Anwendung:: ELISA, WB
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EQTFPSLQPGASTLQRPRSQKRAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASAVPASGVGSPADGLGLPEAGG
Uniprot:: P14652
Synonyme:: homeo box 2H;homeo box B2;homeobox protein Hox-2.8;homeobox protein Hox-2H;homeobox protein Hox-B2;Hox-2.8;HOX2;HOX2H;K8;K8 home protein
Weitere Details:: This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer.